Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183657 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mediator Complex Subunit 27 (MED27) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CRSP8 antibody: synthetic peptide directed towards the C terminal of human CRSP8
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTW
RDFRT LEAFHDTCRQ- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
Sato S, Tomomori-Sato C, Banks CA, Sorokina I, Parmely TJ, Kong SE, Jin J, Cai Y, Lane WS, Brower CS, Conaway RC, Conaway JW
The Journal of biological chemistry 2003 Apr 25;278(17):15123-7
The Journal of biological chemistry 2003 Apr 25;278(17):15123-7
No comments: Submit comment
No validations: Submit validation data