HPA007002

MED27 antibody from MilliporeSigma / Merck KGaA
CRSP34, CRSP8, MED3, TRAP37
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007002
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007002, RRID:AB_1078574
Product name
Anti-MED27 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007002
Antibody type
Polyclonal
Antigen
Mediator of RNA polymerase II transcription subunit 27 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKW
SNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRP
KAQPTTLVLPPQYVDDVISRIDR
Storage
-20C
Provider Type Product Number
- No reagents -