H00022978-M02
antibody from Abnova Corporation
Targeting: NT5C2
cN-II, GMP, NT5B, PNT5, SPG45, SPG65
Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00022978-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00022978-M02, RRID:AB_875749
- Product name
- NT5C2 monoclonal antibody (M02), clone 3C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant NT5C2.
- Antigen sequence
MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRV
FVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGF
ELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTL
YGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNK
FIQRDDTERFYILNTLFNLPETYLLACLVDFFTNC
PRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHY
KGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKV
FLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQ
SYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIG
TYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIG
DHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDK
SSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ
RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVM
RYADLYAASFINLLYYPFSYLFRAAHVLMPHESTV
EHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLT
RSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEE
E- Isotype
- IgG
- Antibody clone number
- 3C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cytosolic 5'-nucleotidase II interacts with the leucin rich repeat of NLR family member Ipaf.
Determination of the enzymatic activity of cytosolic 5'-nucleotidase cN-II in cancer cells: development of a simple analytical method and related cell line models.
Cell proliferation and drug sensitivity of human glioblastoma cells are altered by the stable modulation of cytosolic 5'-nucleotidase II.
Suppression of 5'-nucleotidase enzymes promotes AMP-activated protein kinase (AMPK) phosphorylation and metabolism in human and mouse skeletal muscle.
Cividini F, Tozzi MG, Galli A, Pesi R, Camici M, Dumontet C, Jordheim LP, Allegrini S
PloS one 2015;10(3):e0121525
PloS one 2015;10(3):e0121525
Determination of the enzymatic activity of cytosolic 5'-nucleotidase cN-II in cancer cells: development of a simple analytical method and related cell line models.
Jordheim LP, Puy JY, Cros-Perrial E, Peyrottes S, Lefebvre I, Périgaud C, Dumontet C
Analytical and bioanalytical chemistry 2015 Jul;407(19):5747-58
Analytical and bioanalytical chemistry 2015 Jul;407(19):5747-58
Cell proliferation and drug sensitivity of human glioblastoma cells are altered by the stable modulation of cytosolic 5'-nucleotidase II.
Cividini F, Cros-Perrial E, Pesi R, Machon C, Allegrini S, Camici M, Dumontet C, Jordheim LP, Tozzi MG
The international journal of biochemistry & cell biology 2015 Aug;65:222-9
The international journal of biochemistry & cell biology 2015 Aug;65:222-9
Suppression of 5'-nucleotidase enzymes promotes AMP-activated protein kinase (AMPK) phosphorylation and metabolism in human and mouse skeletal muscle.
Kulkarni SS, Karlsson HK, Szekeres F, Chibalin AV, Krook A, Zierath JR
The Journal of biological chemistry 2011 Oct 7;286(40):34567-74
The Journal of biological chemistry 2011 Oct 7;286(40):34567-74
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NT5C2 expression in transfected 293T cell line by NT5C2 monoclonal antibody (M02), clone 3C1.Lane 1: NT5C2 transfected lysate(64.97 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to NT5C2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to NT5C2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol