HPA003751

NT5C2 antibody from Atlas Antibodies
cN-II, GMP, NT5B, PNT5, SPG45, SPG65
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003751
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003751, RRID:AB_1854664
Product name
Anti-NT5C2
Provider product page
Atlas Antibodies - HPA003751
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMG
SLFRSGSRQTLFASQVMRYADLYAASFINLLYYPF
SYLFRAAHVLMPHESTVEHTHVDINEMESPLATRN
RTSVDFKDTDYKRHQLTRSISEIKPPNLFPLA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -