HPA022023

SPATA20 antibody from Atlas Antibodies
FLJ21347, SSP411, Tisp78
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022023
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022023, RRID:AB_1857417
Product name
Anti-SPATA20
Provider product page
Atlas Antibodies - HPA022023
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SHPSSTPQRVPNRLIHEKSPYLLQHAYNPVDWYPW
GQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESF
QNEEIGRLLSEDFVSVKV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -