HPA031442

antibody from Atlas Antibodies

Targeting: SPATA20 FLJ21347, SSP411, Tisp78

Antibody data

Submit

Validation data

Product number: HPA031442 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031442, RRID:AB_10610557
Product name: Anti-SPATA20
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LAAWNGLMVSGYAVTGAVLGQDRLINYATNGAKFL KRHMFDVASGRLMRTCYTGPGGTVEHSNPPCWGFL EDYAFVVRGLLDLYE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SPATA20 protein structure - HPA031442 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-SPATA20 antibody HPA031442 (A) shows similar protein distribution across tissues to independent antibody HPA027144 (B).
Antibody #2 product nr: HPA027144
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows distinct cytoplasmic positivity in subsets of seminiferous duct cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-SPATA20 antibody HPA031442.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SPATA20 antibody HPA031442.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SPATA20 antibody HPA031442.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SPATA20 antibody HPA031442.
Sample type: HUMAN