HPA022023

SPATA20 antibody from Sigma-Aldrich
FLJ21347, SSP411, Tisp78
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022023
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022023, RRID:AB_1857417
Product name
Anti-SPATA20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022023
Antibody type
Polyclonal
Antigen
Spermatogenesis-associated protein 20 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHPSSTPQRVPNRLIHEKSPYLLQHAYNPVDWYPW
GQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESF
QNEEIGRLLSEDFVSVKV
Storage
-20C
Provider Type Product Number
- No reagents -