WH0051728M1

POLR3K antibody from MilliporeSigma / Merck KGaA
RPC11
ELISA
Recommended by provider

Antibody data

Product number
WH0051728M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0051728M1, RRID:AB_1843066
Product name
Monoclonal Anti-POLR3K antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0051728M1
Antibody type
Monoclonal
Antigen
POLR3K (AAH11932, a.a. 1-109) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNIT
RKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCP
KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHR
WRD* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -