Antibody data

Product number
H00051728-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051728-M01, RRID:AB_530181
Product name
POLR3K monoclonal antibody (M01), clone 3F5
Provider product page
Abnova Corporation - H00051728-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant POLR3K.
Antigen sequence
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNIT
RKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCP
KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHR
WRD
Isotype
IgG
Antibody clone number
3F5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -