Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051728-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051728-B01, RRID:AB_913796
- Product name
- POLR3K MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human POLR3K protein.
- Antigen sequence
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNIT
RKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCP
KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHR
WRD- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of POLR3K expression in transfected 293T cell line (H00051728-T01) by POLR3K MaxPab polyclonal antibody.Lane 1: POLR3K transfected lysate(11.99 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to POLR3K on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol