HPA005891

POLR3K antibody from Sigma-Aldrich
RPC11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005891
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005891, RRID:AB_1079653
Product name
Anti-POLR3K antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005891
Antibody type
Polyclonal
Antigen
DNA-directed RNA polymerases III 12.5 kDa polypeptide recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTN
RKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHP
RAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Storage
-20C
Provider Type Product Number
- No reagents -