HPA016871

TMEM140 antibody from Sigma-Aldrich
FLJ11000
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016871
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016871, RRID:AB_1858091
Product name
Anti-TMEM140 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016871
Antibody type
Polyclonal
Antigen
Transmembrane protein 140 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLTDLPNLRIGFYNFCLWNEDTSTLQCHQFPELEA
LG
Storage
-20C
Provider Type Product Number
- No reagents -