HPA020060

CYREN antibody from Atlas Antibodies
C7orf49, FLJ22450, FLJ27285, MGC5242, MRI, MRI-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020060
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020060, RRID:AB_2290651
Product name
Anti-C7orf49
Provider product page
Atlas Antibodies - HPA020060
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PATRTVYCMNEAEIVDVALGILIESRKQEKACEQP
ALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQA
LAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVR
EI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -