HPA020060

CYREN antibody from Sigma-Aldrich
C7orf49, FLJ22450, FLJ27285, MGC5242, MRI, MRI-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020060
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020060, RRID:AB_2290651
Product name
Anti-C7orf49 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020060
Antibody type
Polyclonal
Antigen
Modulator of retrovirus infection homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PATRTVYCMNEAEIVDVALGILIESRKQEKACEQP
ALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQA
LAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVR
EI
Storage
-20C
Provider Type Product Number
- No reagents -