Antibody data

Product number
H00285195-M01
Provider
Abnova Corporation
Product name
SLC9A9 monoclonal antibody (M01), clone 1E10
Provider product page
Abnova Corporation - H00285195-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC9A9.
Antigen sequence
APTDIESGTVYDCVKLTFSPSTLLVNITDQVYEYK
YKREISQHNINPHQGNAILEK
Isotype
IgG
Antibody clone number
1E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -