HPA024260

WDR91 antibody from Sigma-Aldrich
HSPC049
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024260
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024260, RRID:AB_1844392
Product name
Anti-WDR91 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024260
Antibody type
Polyclonal
Antigen
WD repeat-containing protein 91 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDTEAKKNLCEININDNMPRILSLACSPNGASFVC
SAAAPSLTSQVDFSAPDIGSKGMNQVPGRLLLWDT
KTMKQQLQFSLDPEPIAINCTAFNHNGNLL
Storage
-20C
Provider Type Product Number
- No reagents -