H00004774-M02A

NFIA antibody from Abnova Corporation
KIAA1439, NFI-L

Antibody data

Product number
H00004774-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004774-M02A, RRID:AB_1577693
Product name
NFIA monoclonal antibody (M02A), clone 1E11
Provider product page
Abnova Corporation - H00004774-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant NFIA.
Antigen sequence
MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQA
RKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQK
WASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCVL
SNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGI
PLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKEL
DLYLAYFVHAADSSQSESPSQPSDADIKDQPENGH
LGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFS
LSDLESSSYYSMSPGAMRRSLPSTSSTSSTKRLKS
VEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEP
GMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHH
RPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSH
PAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPN
GSSQGKVHNPFLPTPMLPPPPPPPMARPVPLPVPD
TKPPTTSTEGGAASPTSPILVPGIKVAASHHPPDR
PPDPFSTL
Isotype
IgG
Antibody clone number
1E11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -