HPA006111

NFIA antibody from Sigma-Aldrich
KIAA1439, NFI-L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006111
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006111, RRID:AB_1854422
Product name
Anti-NFIA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006111
Antibody type
Polyclonal
Antigen
Nuclear factor 1 A-type recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKSVEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHE
VEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFT
QHHRPVITGPRASPHATPSTLHFPTSPIIQQ
Storage
-20C
Provider Type Product Number
- No reagents -