HPA021490

PRKD2 antibody from MilliporeSigma / Merck KGaA
DKFZP586E0820, HSPC187, PKD2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021490
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021490, RRID:AB_1855708
Product name
Anti-PRKD2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021490
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase D2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QTWLDLRELEGKMGERYITHESDDARWEQFAAEHP
LPGSGLPTDRDLGGACPPQDHDMQGLAERISVL
Storage
-20C
Provider Type Product Number
- No reagents -