HPA006949

PBXIP1 antibody from Atlas Antibodies
HPIP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006949
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006949, RRID:AB_1079572
Product name
Anti-PBXIP1
Provider product page
Atlas Antibodies - HPA006949
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLPVETLGPASRMDPESERALQAPHSPSKTDGKEL
AGTMDGEGTLFQTESPQSGSILTEETEVKGTLEGD
VCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQDLE
GQSPPQSLPSTPKAAWIR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -