HPA006949

PBXIP1 antibody from Sigma-Aldrich
HPIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006949
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006949, RRID:AB_1079572
Product name
Anti-PBXIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006949
Antibody type
Polyclonal
Antigen
pre-B-cell leukemia transcription factor interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLPVETLGPASRMDPESERALQAPHSPSKTDGKEL
AGTMDGEGTLFQTESPQSGSILTEETEVKGTLEGD
VCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQDLE
GQSPPQSLPSTPKAAWIR
Storage
-20C
Provider Type Product Number
- No reagents -