HPA026687

AASDHPPT antibody from Atlas Antibodies
AASD-PPT, ACPS, CGI-80, LYS5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026687
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026687, RRID:AB_1844414
Product name
Anti-AASDHPPT
Provider product page
Atlas Antibodies - HPA026687
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDD
SKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFC
FTEEIPIRNGTKS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -