HPA026687

AASDHPPT antibody from Sigma-Aldrich
AASD-PPT, ACPS, CGI-80, LYS5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026687
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026687, RRID:AB_1844414
Product name
Anti-AASDHPPT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026687
Antibody type
Polyclonal
Antigen
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDD
SKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFC
FTEEIPIRNGTKS
Storage
-20C
Provider Type Product Number
- No reagents -