HPA024574

NUP205 antibody from Atlas Antibodies
C7orf14, KIAA0225
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024574
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024574, RRID:AB_1854715
Product name
Anti-NUP205
Provider product page
Atlas Antibodies - HPA024574
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LDSIDFSQEIPEPLQLDFFDRAQIEQVIANCEHKN
LRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLL
MEEISTVLQYVVGRNKLLQCLHAKRHALES
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -