HPA024574

NUP205 antibody from Sigma-Aldrich
C7orf14, KIAA0225
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024574
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024574, RRID:AB_1854715
Product name
Anti-NUP205 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024574
Antibody type
Polyclonal
Antigen
Nuclear pore complex protein Nup205 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDSIDFSQEIPEPLQLDFFDRAQIEQVIANCEHKN
LRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLL
MEEISTVLQYVVGRNKLLQCLHAKRHALES
Storage
-20C
Provider Type Product Number
- No reagents -