ABIN630342

antibody from antibodies-online

Targeting: SLC1A5 AAAT, ASCT2, M7V1, RDRC

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630342 - Provider product page
Provider: antibodies-online
Product name: anti-Solute Carrier Family 1 Member 5 (SLC1A5) antibody
Antibody type: Polyclonal
Antigen: SLC1 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
Description: Purified
Reactivity: Human, Mouse, Rat, Canine
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

SLC1A5 protein structure - ABIN630342 shown in red.