Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310308 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 1 Member 5 (SLC1A5) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC1A5 antibody: synthetic peptide directed towards the middle region of human SLC1A5
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMW
YAPVG IMFLVAGKIV- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of the promoter elements involved in the stimulation of ASCT2 expression by glutamine availability in HepG2 cells and the probable involvement of FXR/RXR dimers.
An antimony trichloride reagent suitable for the detection and estimation of nonketonic steroids.
Bungard CI, McGivan JD
Archives of biochemistry and biophysics 2005 Nov 15;443(1-2):53-9
Archives of biochemistry and biophysics 2005 Nov 15;443(1-2):53-9
An antimony trichloride reagent suitable for the detection and estimation of nonketonic steroids.
ROSENKRANTZ H
Archives of biochemistry and biophysics 1953 May;44(1):1-8
Archives of biochemistry and biophysics 1953 May;44(1):1-8
No comments: Submit comment
No validations: Submit validation data