Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107348 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Growth Factor Independent 1B Transcription Repressor (GFI1B) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GFI1B antibody: synthetic peptide directed towards the N terminal of human GFI1B
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVP
RDQAPSNSPVLSTLF- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term
- Handling
- Avoid repeated freezing and thawing.
Submitted references GATA-1 and NF-Y cooperate to mediate erythroid-specific transcription of Gfi-1B gene.
Huang DY, Kuo YY, Lai JS, Suzuki Y, Sugano S, Chang ZF
Nucleic acids research 2004;32(13):3935-46
Nucleic acids research 2004;32(13):3935-46
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate; GFI1B antibody - N-terminal region (AP42015PU-N) in Human Jurkat cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Heart; Rabbit Anti-GFI1B Antibody. Paraffin Embedded Tissue: Human Heart. Cellular Data: Myocardial cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; GFI1B antibody - N-terminal region (AP42015PU-N) in Human Heart cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human kidney; Rabbit Anti-GFI1B Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule and renal corpuscle. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; GFI1B antibody - N-terminal region (AP42015PU-N) in Human kidney cells using Immunohistochemistry