Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007012 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-GFI1B
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QAPSNSPVLSTLFPNQCLDWTNLKREPELEQDQNL
ARMAPAPEGPIVLSRPQDGDSPLSDSPPFYKPSFS
WDTLATTYGHSYRQAPSTMQSAFLEHSVSLYGSPL
VPSTEPALDFSLRYSPGMDAYHCVKCNKVFSTPHG
LEVHVRR- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references GFI1B, EVI5, MYB—Additional genes that cooperate with the human BCL6 gene to promote the development of lymphomas
Enhancer hijacking activates GFI1 family oncogenes in medulloblastoma
Baron B, Anastasi J, Bies J, Reddy P, Joseph L, Thirman M, Wroblewski K, Wolff L, Baron J
Blood Cells, Molecules, and Diseases 2014;52(1):68-75
Blood Cells, Molecules, and Diseases 2014;52(1):68-75
Enhancer hijacking activates GFI1 family oncogenes in medulloblastoma
Northcott P, Lee C, Zichner T, Stütz A, Erkek S, Kawauchi D, Shih D, Hovestadt V, Zapatka M, Sturm D, Jones D, Kool M, Remke M, Cavalli F, Zuyderduyn S, Bader G, VandenBerg S, Esparza L, Ryzhova M, Wang W, Wittmann A, Stark S, Sieber L, Seker-Cin H, Linke L, Kratochwil F, Jäger N, Buchhalter I, Imbusch C, Zipprich G, Raeder B, Schmidt S, Diessl N, Wolf S, Wiemann S, Brors B, Lawerenz C, Eils J, Warnatz H, Risch T, Yaspo M, Weber U, Bartholomae C, von Kalle C, Turányi E, Hauser P, Sanden E, Darabi A, Siesjö P, Sterba J, Zitterbart K, Sumerauer D, van Sluis P, Versteeg R, Volckmann R, Koster J, Schuhmann M, Ebinger M, Grimes H, Robinson G, Gajjar A, Mynarek M, von Hoff K, Rutkowski S, Pietsch T, Scheurlen W, Felsberg J, Reifenberger G, Kulozik A, von Deimling A, Witt O, Eils R, Gilbertson R, Korshunov A, Taylor M, Lichter P, Korbel J, Wechsler-Reya R, Pfister S
Nature 2014;511(7510):428-434
Nature 2014;511(7510):428-434
No comments: Submit comment
No validations: Submit validation data