HPA007012

GFI1B antibody from MilliporeSigma / Merck KGaA
ZNF163B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007012
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007012, RRID:AB_1078964
Product name
Anti-GFI1B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007012
Antibody type
Polyclonal
Antigen
growth factor independent 1B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QAPSNSPVLSTLFPNQCLDWTNLKREPELEQDQNL
ARMAPAPEGPIVLSRPQDGDSPLSDSPPFYKPSFS
WDTLATTYGHSYRQAPSTMQSAFLEHSVSLYGSPL
VPSTEPALDFSLRYSPGMDAYHCVKCNKVFSTPHG
LEVHVRR
Storage
-20C
Provider Type Product Number
- No reagents -