HPA021668

ANKRD40 antibody from Sigma-Aldrich
MGC15396
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021668
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021668, RRID:AB_1844843
Product name
Anti-ANKRD40 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021668
Antibody type
Polyclonal
Antigen
Ankyrin repeat domain-containing protein 40 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NDFIEIELDRQELTYQELLRVCCCELGVNPDQVEK
IRKLPNTLLRKDKDVARLQDFQELELVLMISENNF
LFRNAASTLTERPCYNRRAS
Storage
-20C
Provider Type Product Number
- No reagents -