HPA020017

LUC7L3 antibody from Atlas Antibodies
CRA, CREAP-1, CROP, FLJ11063, hLuc7A, LUC7A, OA48-18
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020017
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020017, RRID:AB_1847249
Product name
Anti-LUC7L3
Provider product page
Atlas Antibodies - HPA020017
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYA
KIKATVEELKEKLRKRTEEPDRDERLKKEKQEREE
REKEREREREERER
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -