Explore
Validate
LearnH00051747-A01
antibody from Abnova Corporation
Targeting: LUC7L3
CRA, CREAP-1, CROP, FLJ11063, hLuc7A, LUC7A, OA48-18
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051747-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051747-A01, RRID:AB_462323
- Product name
- CROP polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CROP.
- Antigen sequence
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVC
KYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQY
EKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHA
RLALS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteome-wide identification of novel binding partners to the oncogenic fusion gene protein, NPM-ALK, using tandem affinity purification and mass spectrometry.
Novel splicing factor RBM25 modulates Bcl-x pre-mRNA 5' splice site selection.
Wu F, Wang P, Young LC, Lai R, Li L
The American journal of pathology 2009 Feb;174(2):361-70
The American journal of pathology 2009 Feb;174(2):361-70
Novel splicing factor RBM25 modulates Bcl-x pre-mRNA 5' splice site selection.
Zhou A, Ou AC, Cho A, Benz EJ Jr, Huang SC
Molecular and cellular biology 2008 Oct;28(19):5924-36
Molecular and cellular biology 2008 Oct;28(19):5924-36
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CROP polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of CROP expression in Y-79 ( Cat # L042V1 ).
