HPA020017

LUC7L3 antibody from MilliporeSigma / Merck KGaA
CRA, CREAP-1, CROP, FLJ11063, hLuc7A, LUC7A, OA48-18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020017
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020017, RRID:AB_1847249
Product name
Anti-AC005921.3-1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020017
Antibody type
Polyclonal
Antigen
Cisplatin resistance-associated overexpressed protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYA
KIKATVEELKEKLRKRTEEPDRDERLKKEKQEREE
REKEREREREERER
Storage
-20C
Provider Type Product Number
- No reagents -