Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108482 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Neuronal PAS Domain Protein 1 (NPAS1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NPAS1 antibody: synthetic peptide directed towards the C terminal of human NPAS1.
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
TIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGL
PYPGPAGTRLPRKGD- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway.
Hogenesch JB, Chan WK, Jackiw VH, Brown RC, Gu YZ, Pray-Grant M, Perdew GH, Bradfield CA
The Journal of biological chemistry 1997 Mar 28;272(13):8581-93
The Journal of biological chemistry 1997 Mar 28;272(13):8581-93
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Jurkat; WB Suggested Anti-NPAS1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate. NPAS1 is supported by BioGPS gene expression data to be expressed in Jurkat.; NPAS1 antibody - C-terminal region (AP42082PU-N) in Human Jurkat cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Stomach; NPAS1 antibody - C-terminal region (AP42082PU-N) in Human Stomach cells using Immunohistochemistry