HPA021224

FAM180A antibody from Atlas Antibodies
HWKM1940, UNQ1940
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021224
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021224, RRID:AB_1851352
Product name
Anti-FAM180A
Provider product page
Atlas Antibodies - HPA021224
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEE
VELLYEFLLAELEISPDLQISIKDEELASLRKASD
FRTVCNN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -