HPA021224

FAM180A antibody from Sigma-Aldrich
HWKM1940, UNQ1940
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021224
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021224, RRID:AB_1851352
Product name
Anti-FAM180A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021224
Antibody type
Polyclonal
Antigen
Protein FAM180A Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEE
VELLYEFLLAELEISPDLQISIKDEELASLRKASD
FRTVCNN
Storage
-20C
Provider Type Product Number
- No reagents -