H00136319-A01

MTPN antibody from Abnova Corporation
GCDP, MYOTROPHIN, V-1
No application information provided.

Antibody data

Product number
H00136319-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00136319-A01, RRID:AB_1139229
Product name
MTPN polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00136319-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant MTPN.
Antigen sequence
MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGG
RKPLHYAADCGQLEILEFLLLKGADINAPDKHHIT
PLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAF
EATDNQAIKALLQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -