Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503395 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Myotrophin (MTPN) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MTPN antibody: synthetic peptide directed towards the middle region of human MTPN
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHI
TPLLS AVYEGHVSCV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sparing of the dystrophin-deficient cranial sartorius muscle is associated with classical and novel hypertrophy pathways in GRMD dogs.
An unconventional antigen translated by a novel internal ribosome entry site elicits antitumor humoral immune reactions.
Nghiem PP, Hoffman EP, Mittal P, Brown KJ, Schatzberg SJ, Ghimbovschi S, Wang Z, Kornegay JN
The American journal of pathology 2013 Nov;183(5):1411-24
The American journal of pathology 2013 Nov;183(5):1411-24
An unconventional antigen translated by a novel internal ribosome entry site elicits antitumor humoral immune reactions.
Xiong Z, Liu E, Yan Y, Silver RT, Yang F, Chen IH, Chen Y, Verstovsek S, Wang H, Prchal J, Yang XF
Journal of immunology (Baltimore, Md. : 1950) 2006 Oct 1;177(7):4907-16
Journal of immunology (Baltimore, Md. : 1950) 2006 Oct 1;177(7):4907-16
No comments: Submit comment
No validations: Submit validation data