HPA009064

ZNF134 antibody from MilliporeSigma / Merck KGaA
pHZ-15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009064
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA009064, RRID:AB_1080668
Product name
Anti-ZNF134 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA009064
Antibody type
Polyclonal
Antigen
Zinc finger protein 134 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DCGKVFRHKSTLVQHESIHTGENPYDCSDCGKSFG
HKYTLIKHQRIHTESKPFECIECGKFFSRSSDYIA
HQRVHTGERPFVCSKCGKDFIRTSHLVRHQRVHTG
ERPYECSECGKAYSLSSHLNRHQK
Storage
-20C
Provider Type Product Number
- No reagents -