Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029795 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029795, RRID:AB_10601357
- Product name
- Anti-CHRM2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS
DSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMT
KQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Dendritic Inhibition Provided by Interneuron-Specific Cells Controls the Firing Rate and Timing of the Hippocampal Feedback Inhibitory Circuitry
Tyan L, Chamberland S, Magnin E, Camiré O, Francavilla R, David L, Deisseroth K, Topolnik L
The Journal of Neuroscience 2014;34(13):4534-4547
The Journal of Neuroscience 2014;34(13):4534-4547
No comments: Submit comment
No validations: Submit validation data