Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502268 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ERMAP antibody: synthetic peptide directed towards the middle region of human ERMAP
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
RSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPK
LILSE DQRCVRLGDR- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references SCER and SCAN: two novel high-prevalence antigens in the Scianna blood group system.
Flegel WA, Chen Q, Reid ME, Martin J, Orsini LA, Poole J, Moulds MK, Wagner FF
Transfusion 2005 Dec;45(12):1940-4
Transfusion 2005 Dec;45(12):1940-4
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting