Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182336 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-TSC22 Domain Family, Member 4 (TSC22D4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TSC22D4 antibody: synthetic peptide directed towards the N terminal of human TSC22D4
- Description
- Protein A purified
- Reactivity
- Human, Porcine
- Host
- Rabbit
- Antigen sequence
SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPP
TGPPP RLPNGEPSPD- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Subcellular TSC22D4 localization in cerebellum granule neurons of the mouse depends on development and differentiation.
THG-1pit moves to nucleus at the onset of cerebellar granule neurons apoptosis.
Human chromosome 7: DNA sequence and biology.
Canterini S, Bosco A, Carletti V, Fuso A, Curci A, Mangia F, Fiorenza MT
Cerebellum (London, England) 2012 Mar;11(1):28-40
Cerebellum (London, England) 2012 Mar;11(1):28-40
THG-1pit moves to nucleus at the onset of cerebellar granule neurons apoptosis.
Canterini S, Bosco A, De Matteis V, Mangia F, Fiorenza MT
Molecular and cellular neurosciences 2009 Feb;40(2):249-57
Molecular and cellular neurosciences 2009 Feb;40(2):249-57
Human chromosome 7: DNA sequence and biology.
Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Döhner H, Döhner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC
Science (New York, N.Y.) 2003 May 2;300(5620):767-72
Science (New York, N.Y.) 2003 May 2;300(5620):767-72
No comments: Submit comment
No validations: Submit validation data