HPA006757

TSC22D4 antibody from Sigma-Aldrich
THG-1, TILZ2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006757
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006757, RRID:AB_1080403
Product name
Anti-TSC22D4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006757
Antibody type
Polyclonal
Antigen
TSC22 domain family protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRME
LGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSP
DPFGAVAAQKFSLAHSMLAISGHLDSDDDSGSGSL
VGIDNKIEQAMDLVKSHLMF
Storage
-20C
Provider Type Product Number
- No reagents -