HPA015068

CREB3L2 antibody from Sigma-Aldrich
BBF2H7, TCAG_1951439
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015068
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015068, RRID:AB_1847224
Product name
Anti-CREB3L2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015068
Antibody type
Polyclonal
Antigen
cAMP-responsive element-binding protein 3-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTH
FSELLDEFSQNVLGQLLNDPFLSEKSVSMEVEPSP
TSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFN
D
Storage
-20C
Provider Type Product Number
- No reagents -