HPA015068

CREB3L2 antibody from Atlas Antibodies
BBF2H7, TCAG_1951439
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015068
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015068, RRID:AB_1233996
Product name
Anti-CREB3L2
Provider product page
Atlas Antibodies - HPA015068
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTH
FSELLDEFSQNVLGQLLNDPFLSEKSVSMEVEPSP
TSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFN
D
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -