HPA015068

CREB3L2 antibody from Atlas Antibodies
BBF2H7, TCAG_1951439

Antibody data

Product number
HPA015068
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015068, RRID:AB_1847224
Product name
Anti-CREB3L2
Provider product page
Atlas Antibodies - HPA015068
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTH
FSELLDEFSQNVLGQLLNDPFLSEKSVSMEVEPSP
TSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFN
D
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.