HPA024373

GATAD2A antibody from Atlas Antibodies
p66alpha
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA024373
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024373, RRID:AB_1849522
Product name
Anti-GATAD2A
Provider product page
Atlas Antibodies - HPA024373
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LERDPTEDDVESKKIKMERGLLASDLNTDGDMRVT
PEPGAGPTQGLLRATEATAMAMGRGEGLVGDGPVD
MRTSHSDMKSERRPPSPDVIVLSDNEQPSSPRVNG
LTTVALKETSTE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -