Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183509 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-GATA Zinc Finger Domain Containing 2A (GATAD2A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GATAD2A antibody: synthetic peptide directed towards the N terminal of mouse GATAD2A
- Description
- Protein A purified
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
MSEEACRTRSQKRTLEPDLTEDDVENKKMKMEKGS
SELTV DGDSRVMPEP- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development.
Ko MS, Kitchen JR, Wang X, Threat TA, Wang X, Hasegawa A, Sun T, Grahovac MJ, Kargul GJ, Lim MK, Cui Y, Sano Y, Tanaka T, Liang Y, Mason S, Paonessa PD, Sauls AD, DePalma GE, Sharara R, Rowe LB, Eppig J, Morrell C, Doi H
Development (Cambridge, England) 2000 Apr;127(8):1737-49
Development (Cambridge, England) 2000 Apr;127(8):1737-49
No comments: Submit comment
No validations: Submit validation data