HPA006759

GATAD2A antibody from Atlas Antibodies
p66alpha
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006759
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006759, RRID:AB_1079549
Product name
Anti-GATAD2A
Provider product page
Atlas Antibodies - HPA006759
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPR
GVLHTFSPSPKLQNSASATALVSRTGRHSERTVSA
GKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSA
VDRQREYLLDMIPPRSIP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -