HPA006759

GATAD2A antibody from Sigma-Aldrich
p66alpha
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006759
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006759, RRID:AB_1079549
Product name
Anti-GATAD2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006759
Antibody type
Polyclonal
Antigen
Transcriptional repressor p66 alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPR
GVLHTFSPSPKLQNSASATALVSRTGRHSERTVSA
GKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSA
VDRQREYLLDMIPPRSIP
Storage
-20C
Provider Type Product Number
- No reagents -